PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01500g01020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 269aa    MW: 30542.2 Da    PI: 7.5382
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01500g01020.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-18117171256
                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Niben101Scf01500g01020.1 117 RKKLRLSKDQSAILEETFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTK 171
                               788899***********************************************98 PP

2HD-ZIP_I/II128.43e-41117206191
               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                               +kk+rlsk+q+++LEe+F+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+
  Niben101Scf01500g01020.1 117 RKKLRLSKDQSAILEETFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQ 201
                               69*********************************************************************************** PP

               HD-ZIP_I/II  86 eLreel 91 
                               eLr +l
  Niben101Scf01500g01020.1 202 ELR-AL 206
                               **9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.5E-18295IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466892.34E-18109174IPR009057Homeodomain-like
PROSITE profilePS5007117.313113173IPR001356Homeobox domain
SMARTSM003897.4E-16115177IPR001356Homeobox domain
PfamPF000463.8E-16117171IPR001356Homeobox domain
CDDcd000862.17E-15117174No hitNo description
Gene3DG3DSA:1.10.10.607.6E-18122171IPR009057Homeodomain-like
PRINTSPR000312.5E-5144153IPR000047Helix-turn-helix motif
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PRINTSPR000312.5E-5153169IPR000047Helix-turn-helix motif
PfamPF021832.0E-11173207IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.2E-27173216IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009826Biological Processunidimensional cell growth
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MMVEKEDLGL SLSLSFPDNN NKTSTTTNNP FHHQLNLIPS SSPFNLFHKT SWTDSFSSSD  60
VNRLPATADA DEEAGVSSPN STISSVSGNK RSERETNNCE EHEMERASDE EDGETSRKKL  120
RLSKDQSAIL EETFKEHNTL NPKQKLALAK RLGLRPRQVE VWFQNRRART KLKQTEVDCE  180
FLKRCCENLT EENRRLQKEV QELRALKLSP QFYMQMTPPT TLTMCPSCER VGGPPTSSDP  240
TSTHVGPAQH RPMPFNLWAN TPKSLHLRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115121SRKKLRL
2165173RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00550DAPTransfer from AT5G47370Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589459.11e-177PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466011e-101HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLA0A0V0HV351e-144A0A0V0HV35_SOLCH; Putative homeobox-leucine zipper protein HAT4-like
STRINGPGSC0003DMT4000675401e-143(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-98homeobox protein 2